PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00145.1_g00025.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 1525aa    MW: 171780 Da    PI: 9.0609
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00145.1_g00025.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding30.86.6e-101443130
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHH CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIart 30
                             +g WT+eEde+l+ +++++G+ +W++I+++
  Rsa1.0_00145.1_g00025.1 14 KGEWTAEEDEKLIAYINEHGMCDWRSIPKR 43
                             799************************997 PP

2Myb_DNA-binding57.53.1e-1813491392146
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding    1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46  
                               rg++T++E+e+++++++ lG++ W++Ia++m  +Rt++++k++w++
  Rsa1.0_00145.1_g00025.1 1349 RGKFTPQEEEKIIKLHAVLGNR-WASIAKHME-NRTDNDIKNHWNS 1392
                               89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512948.142951IPR017930Myb domain
SuperFamilySSF466895.74E-71044IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.1E-91244IPR009057Homeodomain-like
SMARTSM007170.0351355IPR001005SANT/Myb domain
PfamPF002491.5E-71443IPR001005SANT/Myb domain
CDDcd001675.55E-61643No hitNo description
SuperFamilySSF562192.75E-3346274IPR005135Endonuclease/exonuclease/phosphatase
Gene3DG3DSA:3.60.10.101.3E-1946273IPR005135Endonuclease/exonuclease/phosphatase
PfamPF033726.9E-1247266IPR005135Endonuclease/exonuclease/phosphatase
SuperFamilySSF566721.78E-17482761No hitNo description
PROSITE profilePS5087811.991514778IPR000477Reverse transcriptase domain
CDDcd016501.05E-49532795No hitNo description
PfamPF000781.6E-38539765IPR000477Reverse transcriptase domain
PfamPF139665.0E-1910181113IPR026960Reverse transcriptase zinc-binding domain
Gene3DG3DSA:3.30.420.108.8E-612211301IPR012337Ribonuclease H-like domain
SuperFamilySSF530981.39E-812211334IPR012337Ribonuclease H-like domain
CDDcd062224.15E-1412231335No hitNo description
PfamPF134562.2E-1712241335No hitNo description
SuperFamilySSF466893.08E-1813381401IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.5E-2513391398IPR009057Homeodomain-like
PROSITE profilePS5129428.79613441398IPR017930Myb domain
SMARTSM007173.7E-1713481396IPR001005SANT/Myb domain
PfamPF002491.4E-1613491393IPR001005SANT/Myb domain
CDDcd001675.18E-1113511391No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1525 aa     Download sequence    Send to blast
MGRKTWFDDD GMKKGEWTAE EDEKLIAYIN EHGMCDWRSI PKRAVVVSWN CCDIGNPQTV  60
QRLMDLNSKC SPDIIFLSET RNIDSTVLTE VQPLHMDSHF LVSPSPTNGG GLAILWKQGI  120
DIQILASSQN FIDTLITFKN VSFNSTFVYG APEIPNRQAV WDQLSGIATS RDSPWFLTGD  180
FNEITNSDEK SGGKMRPESS FTAFRTFLSS CDLFDLKHSG NFLSWRGKRH NHLVHCRLDR  240
AMANSTWMDL FPNGRSHYLP FEGSDHRPIL STFDSKKKKP QKLFRYDRRL RDNEEIKEIV  300
DRTWNENPNL SVAQRISNCR GEIAAWSKKN YLNSRKEIEE LRKKLDKAMS DMIADDLLIS  360
QINQRLLHSY KAEEEFWKQR SRQLWLTLGD KNTGFFHAST KSRRARNKLT VIEDPSGTPV  420
FEEEQIVKVI SDYFQHIFDS TSPSATVVVN RALTPCISTS TNEALIAIPS SAEIKTALFG  480
IHPDKAPGPD GFSASFFQSN WNAIGPAVTK EIQYFFSTGS LPCTINNTHI RLIPKIQSPK  540
QVSDYRPIAL CNVYYKIISK LLSLRLKPVL QDIVSENQSA FIPDRAISDN VLITHEMLHY  600
LKNSAATVHC SMAVKTDISK AYDRLEWSFI QAVMKRLGFD HTWIQLIMQC ITTVSYSFLI  660
NNTVAGCVTP QRGIRQGDPL SPYIFILCGE VLSGLCKKAQ INGTMAGLRV ARKSPRLNHL  720
LFADDTMFFT KTDPQSCSTL MEILNGYESA SGQMINVAKS SISFSAKTPP EVKMRVKLHL  780
KIEKEGGVGK YLGLPEHFGR KKKDLFSSIV DRMLQRALNY SSRFLSKAGK ATMLQAVLSA  840
IPTFAMTCFE IPISLCKRIQ SVLTRFWWDS EHGVNKIAWV AWDTLTLPKG LGGKYYTTTS  900
FLKVEAAKAS SHGWKGILKG RDLLLTHLGK VIGDGETTSV WKDAWISPTS ALKPAGPVLE  960
GDQDLLVSDL LSRETKEWNK ARVNNLLPEL TSQILAIRPS THGAPDTHVW TFHASGEYSA  1020
KSGYLSLQSA KVQSTSILLN AVNNYWNWNK LIWSVQMLPK IKFFLWQVCQ RALPTGENLQ  1080
KRGLLVPPLC CRCGEQETTL HLLFHCPFAK EVWSLGPWNH SFDSSQISSI KEALILSNSW  1140
ITLPPFGFSI NIVPWICWFL WISRNKLTFE KKPSTAVEVI TTSIVATREW ERAQPLKTKR  1200
TASQPTSRQP TIHQPSPPST LFCNTDAAWR ADTGKAGLAW IFTTLQGQEL NRGSLFQDHV  1260
SSACMAEALA IKNALLHAID LNYNHIWLRS DSQVLIGAIS TGRHPTELYG VLSDIASLSS  1320
SFSFCRFSFI KRELNGLRWL NYLRPGIKRG KFTPQEEEKI IKLHAVLGNR WASIAKHMEN  1380
RTDNDIKNHW NSCLKKKLSR NGIDPMTHEP INNNLTVTTT YVECGSSSTT TGPTTESHCS  1440
SAPSGSACLL NKLAAGISSR QYDLNMIKNI LFDPRTTSNY QGDKEEAKRD QKIGGCEEEG  1500
DFLIWDDEEV RRQGRLLARA SGAVE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-151315139918109B-MYB
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009118883.10.0PREDICTED: uncharacterized protein LOC103843855
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM229
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18710.19e-54myb domain protein 47